242 Websites:Organisations:Summaries:Related categories:Related keywords:Related locations:
sophieskincare.nlSophie SkincareThe website Sophie Skincare is a laser, hair, and skin therapy clinic located in Voorburg, offering various treatments for skin, hair, and body conditions.Dermatology → Skin Therapy 661 Medical Care & Services → Cosmetic Medicine 1065 skinboosters 25 skin therapy 221 laser hair removal 294 laser 868 treatment 21203 Leidschendam-Voorburg → Voorburg 1234
salon2punt0.nlSalon 2.0Salon 2.0 is a hair salon specializing in hair systems, wigs, and treatments for hair loss and thinning hair, with 30 years of experience.Hair Care → Hair Extensions 282 Cosmetics & Aesthetic → Dermatology 1980 dermatology 127 hairpiece 153 scalp 154 wig 210 hairdresser 1372 North-Brabant → Asten 807
harmonyskinclinic.nlHarmony Skin & Laser ClinicHarmony Skin Clinic is a skin therapy practice specializing in skin improvement and hair loss treatment, located in Badhoevendorp and Amsterdam.Dermatology → Skin Therapy 661 Traffic Management → Parking 508 mesotherapy 56 laser therapy 142 skin therapy 221 skin improvement 1058 skin 2518 North-Holland → Amsterdam 41253
beautyskingo.nlBeauty Skin GoThe Beauty Skin Go website in Emmeloord offers a range of beauty treatments focused on hair care, facial treatments, and skin rejuvenation.Hair Salons → Hair Trends 225 Dermatology → Skin Therapy 661 laser 868 skin 2518 massage 7646 treatment 21203 Noordoostpolder → Emmeloord 1649
balmey.nlHair Couture BalmeyThe website of Hair Couture Balmey presents itself as a salon specializing in wigs and hair extensions, with extensive experience (35 years) in the hair restoration field. The aim is to provide a suitable and personalized solution for individuals experiencing hair loss.Hair Care → Hair Extensions 282 Medical Care & Services → Cosmetic Medicine 1065 personalized attention 55 wig 210 Utrecht → De Bilt 1676
mhp-laser.nlMHP LaserMicro hair pigmentation is presented as a solution for hair loss and baldness.Hair Care → Hair Loss 94 Beauty → Cosmetic Procedures 1147 micro hair pigmentation 19 tattoo removal 26 pigmentation 98 scar 142 laser treatment 158
hairlabs.nlHair Labs BVHair Labs is a webshop offering hair care products, treatments, and accessories to help customers achieve healthy, shiny, and fuller hair.Hair Care → Hair Loss 94 haircare 469 styling 2331 hair 3014 gift 6442
hasci.nlHair Science ClinicThe website provides information about the causes and treatments of different forms of hair loss.Dermatology → Hair Growth 10 Medical Care & Services → Plastic Surgery 281 hair transplantation 24 result 1902 technique 2157
fellos.nlFellosFellos is an online healthcare platform offering digital treatments for men with erectile dysfunction, hair loss, and other sexual health issues.Disease & Treatment → Medical Information 305 Children’s Issues → Human Health 37 medical team 10 erectile dysfunction 57 intake 467 treatment 21203
betterhair.nlBetterHairBetterHair for men is a website offering a solution for male hair loss and baldness.Dermatology → Hair Problems 76 Men’s Issues → Male Health 144 hair follicle 14 ingredients 2346 hair 3014 growth 4054
cocorico.nlCocoricoThe website of Cocorico is an online platform and physical store specializing in wigs and hairpieces, with a long tradition and focus on expert advice and personalized service.Hair Care → Hair Loss 94 Accessories → Hair Accessories 127 hairpiece 153 wig 210 styling 2331
hairgivers.nlHairgiversThe website Hairgivers offers hair growth products, advice and supplements to treat hair loss and stimulate hair growth.Hair Care → Hair Loss 94 hair fibers 12 shampoo 258 supplement 1968
thebbar.nlThe B BarHair loss is a common problem treated with techniques such as C.Y.J. Hairfiller and PRP.Cosmetic Medicine → Injectables 39 Cosmetics & Aesthetic → Dermatology 1980 prp 56 dermatology 127 injectables 153 filler 293
capelli-medi.nlCapelli Medi DrutenThe practice treats various forms of hair loss, such as male and female baldness.Cosmetics & Aesthetic → Dermatology 1980 Health → Medical Care & Services 29461 scalp 154 wellness 1561 treatment 21203 Gelderland → Druten 590
onlineshampoo.nlOnlineshampooThe website acknowledges hair loss as a common problem for both men and women.Hair Salons → Hair Care 2849 Cosmetics & Aesthetic → Dermatology 1980 conditioner 79 shampoo 258
haarstichting.nlDutch Hair FoundationThe Dutch Hair Foundation is an online platform that supports and informs people with hair problems and hair diseases.Social Organization → Charities 2419 Medical Care & Services → Cosmetic Medicine 1065 dermatologist 62 hairpiece 153 hairdresser 1372 hair 3014
trixbasic.nlHair Clinic CentreThe website offers a natural hair growth supplement, TRIX Basic, for various types of hair loss.Hair Care → Hair Loss Treatment 12 dermatologist 62 natural ingredients 84 supplement 1968 patient 4082 treatment 21203
hebjehaarweer.nlN/AThe website provides hair care tips and products focused on women, with specific attention to hair loss, damaged hair, and finding suitable products for various hair types.Hair Salons → Hair Care 2849 hair type 23 scalp 154 shampoo 258 hair products 301 hair 3014
waerknoppele.nlWaerknoppeleThe website Waerknoppele provides articles and blogs on various topics, including health, cosmetic procedures, caregiving, and addiction.Care → Elderly 82 Theater → Theater Productions 22 cocaine 10 caregiver 1167
mainlymarlot.nlMainlymarlotThe website, Mainlymarlot, presents a collection of articles and discussions on various topics, including beauty, home decor, travel, and lifestyle.Living & Dining → Sofa Beds 13 Men’s Issues → Men 92 sofa 481 home 7976 furniture 8751
beautyvoordeelshop.nlBeautyvoordeelshop.nlThe website offers a variety of information and articles on beauty, skincare, hair care, and trends.Health → Medical Care & Services 29461 cryolipolysis 84 haircare 469 beauty 684 skincare 1972
eerlijkoverhaaruitval.nlNoneThe blog specifically focuses on the problem of hair loss and the search for solutions.Hair Care → Hair Loss 94 Personal Stories → Blogs 33
articoupe.nlArticoupeArticoupe provides solutions for hair loss and offers hair extensions that seamlessly integrate with natural hair.Hair Care → Hair Loss 94 Trauma & Recovery → Loss 714 hairstyle 812 confidence 1163 privacy 1286 extension 1941 hair 3014 Meierijstad → Veghel 1288
zuyderziel.nlZuyderzielThe website Zuyderziel provides information and articles on various topics related to wellness, health, beauty, and lifestyle.Hair Education → Hair Products 612 handbag 82 perfume 534 cup 648 makeup 1477 wellness 1561
kliniekveldhoven.nlKliniek VeldhovenThe site provides information on hair transplants as a proven method to treat hair loss, emphasizing the focus on effective solutions.Medical Care & Services → Primary Care 5699 breast augmentation 30 eyelid correction 53 treatment 21203
sander-duren.nlsander-duren.nlThe website offers a variety of products and services including motorcycle clothing, ski helmets, Christmas sweaters, piano tuning, weight loss programs, and bicycle helmets.Skiing → Ski Equipment 36 piano tuner 13 christmas sweater 20 motorcycle clothing 80 helmet 236 South-Holland → Dordrecht 4531
925people.nlDe Redactie B.V.The website provides a diverse selection of articles and blogs on various topics, including home improvement, business advice, health, travel, and more.Roofing → Skylights 471 Administrative Support → Business Operations 1156 mobility scooter 86 building materials 486 article 6000
medi-kliniek.nlMedikliniek AmsterdamThe clinic offers solutions for various forms of hair loss, including PRP treatments and hair transplants.Beauty → Cosmetic Procedures 1147 prp 56 hair transplant 64 skin treatment 81 injectables 153 filler 293
intermedica.nlIntermedica KliniekThe Intermedica Clinic offers solutions for hair loss, hair loss, and baldness by advising and treating dermatologists.Primary Care → Clinics 1009 Cosmetics & Aesthetic → Dermatology 1980 dermatologist 62 diagnosis 1490 treatment 21203 Gelderland → Wijchen 1579
finasteride.nlFinasteride.nlThe website is specifically focused on men experiencing hair loss and seeking a solution.Pharmaceuticals & Medical Products → Medications 232 alopecia 19 enzyme 40
haaruitval-online.nlHaaruitval-online.nlThe website addresses the causes and treatments of hair loss, emphasizing that the solutions differ from person to person.Hair Care → Hair Loss 94 hair growth 32 hair 3014 treatment 21203
hairmasters.nlHairmastersThe Hairmasters website presents itself as the specialist in hair replacement solutions in the Netherlands, offering advice, products and services to individuals experiencing hair loss, thinning hair, or baldness.Hair Care → Hair Loss 94 Dermatology → Alopecia 45 hairpiece 153 insurance 6359 Overijssel → Almelo 2696
harmonylife.nlHarmony LifeThe website offers high-quality hair, body, and facial care products, focused on stimulating hair growth, addressing hair loss, and improving overall beauty.Hair Salons → Hair Care 2849 Hair Education → Hair Products 612 set 720 hair 3014 care 12338 treatment 21203
omorfy.nlOmorfy HaarkliniekOmorfy Haarkliniek helps patients with hair loss by offering specialized treatments.Dermatology → Hair Clinic 20 Medical Care & Services → Plastic Surgery 281 hair transplantation 24 filler 293 knowledge base 569 consulting 3639
fondueoost.nlN/AThe site describes the causes of hair loss, including genetic factors.Living & Dining → Sofa Beds 13 Beds → Folding Beds 18 sofa bed 34 baby clothing 309 christmas 320 travel 7210 news 15293
prijscpa.nlPrijscpa.nlThe website addresses hair loss as an emotional and frustrating experience, with information about Folifort.Appearance → Men 27 Physical Fitness & Exercise → Weight Loss 1147 erectile dysfunction 57 weight loss 678 diabetes 750
beautykrant.nlBeautykrantBeautykrant is a website that provides tips and news about beauty.Dermatology → Skin Conditions 61 Hospital & Acute Services → Hospitals 735 dental health 34 clothing line 49 skin 2518 shoes 2699 accessories 12975
thgn.nlTHGN.nlTHGN.nl provides information and a directory of hair professionals and wigs to help people dealing with hair loss cope with this issue.Hair Care → Hair Loss 94 Hair Accessories → Wigs 10 hairpiece 153 wig 210 hairdresser 1372 salon 5541
erasmusobservatoryonhealthlaw.nlErasmus Observatory On HealthlawThe Erasmus Observatory On Healthlaw is a website that publishes information and articles on various aspects of the healthcare sector, aimed at promoting professional development and informing the public.Hospital & Acute Services → Hospitals 735 Children’s Issues → Human Health 37 sperm 20 care home 130 healthcare 2316 article 6000 health 6366
justhair.nlJusthairJusthair is a specialist in hairpieces, wigs, and hair extensions, offering solutions for hair problems and hair loss.Hair Care → Hair Extensions 282 hairpiece 153 hair products 301 consulting 3639 salon 5541 Utrecht → Amersfoort 8011
setcafe.nlSetcafe.nlThe website, Setcafe.nl, presents articles and blogs on various health topics, including hair loss, beard implantation, ketamine, and rhinoplasty.Medical Care & Services → Cosmetic Medicine 1065 Health → Mental & Emotional Well-Being 23704 rhinoplasty 21 beard 468
mm-haarmode.nlMarco & Miranda’s HaarmodeMarco & Miranda’s Haarmode is a hair salon in Haren that focuses on hair improvement and offers various services, including color treatments and hairstyles.Services → Hairdressers 1021 curls 229 hair extension 384 coffee 3838 salon 5541 Groningen → Haren 805
finasteride-kopen.nlFinasteride-kopen.nlThe website specifically focuses on providing a solution for male pattern baldness (Androgenetic Alopecia).Hair Care → Hair Loss 94 prescription 859 order 6912 brand 17737
comparecosmetica.nlComparecosmetica.nlComparecosmetica.nl is a website that recommends and presents cosmetic and skincare products in an organized manner.Hair Salons → Hair Care 2849 Wellness → Beauty Stores 46 haircare 469 cosmetics 648 makeup 1477 skincare 1972
pruikenthuiszorg.nlMichèle Häcker Haarwerken Pruiken Thuiszorg NederlandThe website of Michèle Häcker Haarwerken offers hair solutions and support for people experiencing hair loss, including wigs and custom-made hairpieces.Hair Care → Hair Loss 94 Dermatology → Alopecia 45 hairpiece 153 wig 210 blog 13392
drsplinck.nlDr. E. PlinckThe website of Dr. E. Plinck provides information and treatments for hair loss, targeting both men and women, and addresses the causes and treatments of hair loss across different seasons.Hair Education → Hair Products 612 Cosmetics & Aesthetic → Dermatology 1980 serum 162 shampoo 258 treatment 21203
nrc-rottweiler.nlNRCThe website provides information about the Rottweiler breed, including its origin, behavior, health, and crosses.Breed → Rottweiler 18 Nature → Zoology 180 husky 15 rottweiler 28 origin 71 cross 88 behavior 1779
haaruniek.nlHaarUniekHaarUniek is a salon in Oss specializing in the fitting and sale of professional wigs and hair extensions, as well as treatments for hair problems.Hair Care → Hair Loss 94 Dermatology → Hair Problems 76 hair problem 30 wig 210 hair extension 384 diagnosis 1490 North-Brabant → Oss 2962
adonisadonis.nlAdonisAdonis is an online hair clinic offering prescription medication for hair loss.Pharmaceuticals & Medical Products → Medications 232 pharmacy 702 prescription 859 doctor 1397 hair 3014
koopfinasteride.nlN.V. N.V.Hair loss is the subject of the website, which offers information and tips for treating the condition with finasteride.Men’s Issues → Men’s Health 12 Health → Pharmaceuticals & Medical Products 2409 vendor 128 price 8328 brand 17737
pruikbijuthuis.nlPruik bij u ThuisThe website recognizes the impact of hair loss on a woman’s daily life and offers solutions to conceal it and accept it.Hair Care → Hairpieces 18 Mental & Emotional Well-Being → Self-Esteem 37 hairpiece 153 wig 210 self-confidence 1173
hair-professionals.nlHair ProfessionalsHair Professionals is a hair specialist in Meppel offering medical and cosmetic hair solutions to help with hair problems.Dermatology → Alopecia 45 Hair Salons → Hair Care 2849 alopecia 19 hairpiece 153 wig 210 intake 467 Drenthe → Meppel 1903
ernablokhaarprotheses.nlErna Blok HaarprothesesThe website of Erna Blok Haarprotheses offers custom-made hairpieces based on the expertise of an experienced hairwork specialist with over 50 years of experience.Hair Care → Hair Loss 94 Textile Arts → Crafts 9117 hairpiece 153 wig 210 technique 2157 workshop 19325
haarwerkeneindhoven.nlLiVage Haarwerken EindhovenThe company focuses on assisting individuals experiencing temporary or long-term hair loss.Dermatology → Alopecia 45 Services → Hairdressers 1021 hairpiece 153 wig 210 hair extension 384 North-Brabant → Eindhoven 11845
menblog.nlMenBlogMenBlog is a website that provides articles and information for men on various topics.Appearance → Men 27 Men’s Issues → Men 92 muscle building 23 crypto 384 health 6366 car 10865
hairfusion.nlHairfusion B.V.Hairfusion is a product specifically aimed at stopping hair loss and stimulating natural hair growth.Hair Care → Hair Loss 94 hair growth 32 hair color 94 vitamin 469 hair 3014
capelle-haarwerken.nlCapelle HaarwerkenCapelle Haarwerken is a recognized specialist offering custom-made hairworks for men and women, with a particular focus on hair loss solutions.Hair Education → Hair Products 612 Dermatology → Scalp Care 402 hairwork 75 salon 5541 Overijssel → Zwolle 7395
hairconsultancy.nlHair Consultancy BussumHair Consultancy Bussum is a hair stylist specializing in creating hair extensions using 100% European, untreated hair, primarily for individuals experiencing hair loss or seeking cosmetic hair solutions.Hair Care → Hair Extensions 282 Dermatology → Alopecia 45 supplementation 14 hair extension 384 atelier 1417 hair 3014 Gooise Meren → Bussum 2201
harteleyn.nlharteleynHair loss is mentioned as a potential cause of self-confidence problems and is addressed.Cosmetics & Aesthetic → Dermatology 1980 Cosmetics & Aesthetic → Medical Procedures 10 sweat 22 hair transplantation 24 cosmetic treatments 34 appearance 248 summer 483
hairclinicwolf.nlHair Clinic WolfThe Hair Clinic Wolf website provides expert hair treatments, particularly hair transplants, and offers information and services related to hair loss and hair growth.Dermatology → Hair Growth 10 Dermatology → Hair Transplantation 17 dna test 21 hair transplant 64 aftercare 224
secrethair.nlSecretHairThe website highlights the provision of solutions for hair loss in men and women, with a personalized approach.Hair Salons → Hair Trends 225 Cosmetics & Aesthetic → Dermatology 1980 hairwork 75 hairpiece 153 South-Holland → Delft 5309
lancia-haartechniek.nlLancia HaartechniekLancia Haartechniek is a hair clinic specializing in hairworks and solutions for hair problems, with a focus on personal guidance and a natural result.Hair Care → Hair Loss 94 Dermatology → Hair Problems 76 hairwork 75 cut 926 style 2348 hair 3014 Teylingen → Sassenheim 599
kapsalonficarool.nlKapsalon Ficarool/LiVage HaarwerkenThe salon offers specific solutions for hair loss, including expertise and advice for people with alopecia or chemotherapy-induced hair loss.Hygiene & Environmental Factors → Living 546 hairwork 75 hairpiece 153 wig 210 insurance 6359 Castricum → Akersloot 242
avenuehaarwerk.nlAvenue HaarwerkAvenue Haarwerk is a specialist providing sustainable solutions for hair loss, with a focus on finding a stylish and personalized hair system solution.Hair Education → Hair Products 612 Dermatology → Hair Problems 76 wig 210 styling 2331
ecohaircare.nlEco HaircareThe Eco Haircare webshop offers ecological and sustainable hair products, including shampoos, conditioners, styling products, and treatments from various brands.Cosmetics & Skincare → Cosmetics 1122 Hair Salons → Hair Care 2849 styling product 55 shampoo 258 hair products 301 brand 17737
dierkinghaarinstituut.nlDierking HaarinstituutThe website addresses various causes of hair loss, including alopecia and chemotherapy-related hair loss.Hair Salons → Hair Care 2849 Disease & Treatment → Diseases 829 hairpiece 153 wig 210 hair 3014 Rheden → Velp 700
nisim.nlNisim Hair & Skin ShopThe website offers specific products for treating hair loss, aimed at stimulating hair growth and restoring hair loss.Dermatology → Skin Conditions 61 Pharmaceuticals & Medical Products → Health Products 134 psoriasis 24 rosacea 26 hair growth 32 shampoo 258 skincare 1972
beauclinic.nlBeauclinicThe website addresses various types of hair loss and offers solutions to combat hair loss.Primary Care → Clinics 1009 Dermatology → Hair Transplantation 17 hair transplant 64
shampoonista.nlShampoonistaThe website provides information on causes and treatments for hair loss, often related to nutrition and lifestyle.Hair Care → Hair Loss 94 shampoo 258 hair products 301 hair 3014 nutrition 4935
haarvriendelijk.nlHaarvriendelijkHaarvriendelijk offers courses and training programs specializing in hair and scalp problems and sustainable hair care.Dermatology → Skin Problems 31 Adult & Continuing Learning → Professional Training 1224 scalp 154 hair 3014 course 14728 Gelderland → Apeldoorn 6996
keppie.nlKeppieThe website offers comfortable sleep caps, specifically designed for individuals experiencing hair loss, often as a result of chemotherapy.Cancer → Chemotherapy 11 Accessories → Caps 55 warmth 86 cap 136 comfort 1473
skintechpharma.nlSkin Tech PharmaSkin Tech Pharma offers targeted creams and serums for general and specific skin improvement and issues.Cosmetics & Skincare → Skincare 1070 pigment 142 serum 162 cream 261 skin 2518 treatment 21203
ixxi-haarwerken.nlIxxi HaarwerkenThe website of Ixxi Haarwerken in Drunen provides information and services related to hair extensions, wigs, hair loss issues, and scalp problems, focusing on a personalized and professional approach.Hair Care → Hair Extensions 282 scalp 154 wig 210 hair extension 384 reimbursement 465 Heusden → Drunen 652
poetryalive.nlPoetry AliveThe website Poetry Alive provides a diverse range of articles and information covering topics including hair care, fashion, business solutions, health, and children’s play.Hair Care → Hair Loss 94 mesotherapy 56 hair color 94 play 631 health 6366
ambulancecontrol.nlAmbulance ControlThe website provides information on various medical and healthcare topics, including foot care, oral health, hair loss, eyelid corrections, funeral care, and projects requiring custom drawstrings.Anatomy & Systems → General Health 105 Disease & Treatment → Medical Information 305 funeral care 135 oral health 686 foot 1929
hairresetjantien.nlHairreset Instituut Jantien HarkemaHairreset Instituut Jantien Harkema is a specialist in hairpieces and addressing scalp and hair problems.Cosmetics & Skincare → Cosmetics 1122 Cosmetics & Aesthetic → Dermatology 1980 hairpiece 153 scalp 154 Netherlands → Friesland 27911
haarfijnshop.nlHaarfijnShopThe webshop specializes in products to combat hair loss, such as Nanogen and the Plantur 39 line.Hair Salons → Hair Care 2849 Hair Education → Hair Products 612 beauty products 66 hair products 301 discounts 795
haarmeso.nlNewave Kliniek B.V.Haarmeso offers a treatment to reduce or stop hair loss.Medical Care & Services → Cosmetic Medicine 1065 hyaluronic acid 51 mesotherapy 56 scalp 154 hair 3014 North-Holland → Amsterdam 41253
hairways.nlHairwaysHairways is a hair salon and specialist in Amsterdam focusing on solving hair problems, offering hair extensions and wigs, and providing medical treatments for hair loss.Dermatology → Hair Problems 76 hairwork 75 wig 210 hair extension 384 haircare 469 North-Holland → Amsterdam 41253
haarwerkexpert.nlHaarwerk ExpertHaarwerk Expert is a specialist in wigs and hair extensions, offering advice and products for various hair problems.Hair Salons → Hair Care 2849 Hair Education → Hair Products 612 wig 210 hair extension 384 hairstyle 812 analysis 1615 hair 3014 Utrecht Hill Ridge → Driebergen-Rijsenburg 237
movehs.nlMoveHs HairsolutionsThe website of MoveHs Hairsolutions offers hair solutions, hairpieces and accessories to people experiencing hair loss.Accessories → Hair Accessories 127 Children’s Issues → Human Health 37 hairpiece 153 Flevoland → Almere 7765
haaronderzoekscentrum.nlHaaronderzoekscentrumThe Haaronderzoekscentrum offers hair research, advice, and treatments for hair loss, focusing on identifying the cause and providing tailored solutions.Hair Care → Hair Loss 94 Health → Pharmaceuticals & Medical Products 2409 test 769 research 8967 treatment 21203
tanjashaarmode.nlTanja's HaarmodeThe salon offers solutions for hair loss due to various causes, such as chemotherapy and alopecia.Hair Care → Hair Extensions 282 Cosmetics & Aesthetic → Dermatology 1980 hairpiece 153 wig 210 salon 5541 appointment 13510 North-Holland → Amsterdam 41253
micro-haarpigmentatie.nlMHP SpecialistMicro hair pigmentation is often applied to hair loss and thinning hair, allowing for a more natural appearance.Hair Care → Hair Loss 94 Medical Care & Services → Cosmetic Medicine 1065 scar 142 pigment 142 hair 3014 treatment 21203
mhpnederland.nlMHP NederlandThe treatments are focused on camouflaging hair loss through pigmentation.Dermatology → Hair Clinic 20 Dermatology → Hair Problems 76 micro hair pigmentation 19 scar treatment 21 consulting 3639 North-Holland → Amsterdam 41253
haarspecialisten.nlSikkenk haarspecialistenSikkenk haarspecialisten is a company specializing in hair extensions and hair problem solutions.Dermatology → Hair Problems 76 Children’s Issues → Human Health 37 hairpiece 153 hairstyle 812 comfort 1473 story 8285
margel.nlMarGel hairwork specialistMarGel hairwork specialist offers custom-made hairpieces and wigs, with expertise in hair loss solutions.Hair Education → Hair Products 612 weft 13 hairpiece 153 wig 210 extension 1941
locerin.nlN/AThe product is designed to prevent and fight hair loss, helping women maintain a healthier hair pattern.Hair Care → Hair Loss 94 appearance 248 supplement 1968 ingredients 2346 hair 3014 growth 4054
haarinstituutsmeets.nlHaarinstituut SmeetsHaarinstituut Smeets is a specialized company offering hairpiece fitting, creation, placement, and maintenance services, with a long tradition.Hair Salons → Hair Care 2849 hairpiece 153 salon 5541
assisthelpt.nlAssist HelptAssist Helpt is a website providing information on a wide range of topics related to health, well-being, retirement, fertility, and work absence.Anatomy & Systems → General Health 105 Employment & Labor → Labor Market 580 case management 105 fertility 289 retirement 406 medicine 435 physiotherapy 4688
headcovers.nlHeadcovers Hilde van KersenThe website describes hair loss as a difficult phase in the disease process, where the headcover offers a solution.Cancer → Chemotherapy 11 Accessories → Hats 177 chemotherapy 35 wig 210 cotton 365 comfort 1473
hiia.nlHaarinstituut Ingrid AdriaensenThe salon specifically focuses on treating hair loss and its causes.Hair Care → Hair Extensions 282 Dermatology → Scalp Care 402 scalp 154 wig 210 extension 1941 skin 2518 hair 3014 Gilze and Rijen → Rijen 493
beautyfeit.nlBeautyfeitBeautyfeit.nl is a website that provides information and tips on beauty, fashion, lifestyle, and health.Essential → Wellness 41411 beauty 684 blog 13392
ellahaarwerk.nlEllaHaarWerkEllaHaarWerk is a hairworks specialist that helps people look good after hair loss.Hair Care → Hair Loss 94 Disease & Treatment → Conditions 174 hairwork 75 wig 210 hair salon 717 hairdresser 1372 studio 5465 Zuidplas → Moordrecht 332
pharma-hermetic.nlPharma HermeticThe website of Pharma Hermetic offers natural and innovative products against hair loss and provides a solution for various forms of hair loss.Supplements → Natural Supplements 152 Dermatology → Hair Problems 76 follicle 10 formula 287
haarknopen.nlhaarknopen.nlThe website addresses various causes of hair loss, including medications and alopecia.Hair Salons → Hair Care 2849 wig 210 repair 14576 maintenance 20093
shampoospecialist.nlShampoospecialist B.V.Shampoospecialist.nl is an online store specializing in Kerastase hair products, including shampoos, conditioners, masks, and styling products, offering them at the lowest prices in the Netherlands.Hair Salons → Hair Care 2849 Wellness → Beauty Stores 46 conditioner 79 shampoo 258 mask 381
vanpeltwebshop.nlVan Pelt KappersVan Pelt Kappers is an online shop offering hair products and hair care products for various hair types and hair problems.Accessories → Hair Accessories 127 Hair Education → Hair Products 612 styling product 55 conditioner 79 shampoo 258
hbhairstylers.nlHB HairstylersHB Hairstylers is a salon offering hair styling and care services for both men and women.Dermatology → Scalp Care 402 hair 3014 color 4159 salon 5541
hairtattoolimburg.nlHair Tattoo LimburgMicro Hair Pigmentation (MHP) is a method to camouflage hair loss and bald patches.Dermatology → Hair Problems 76 Cosmetics & Skincare → Cosmetics 1122 follicle 10 scalp 154 tattoo 799
hairlooksimone.nlHairlook SimoneHairlook Simone is a hair salon in Lichtenvoorde specializing in various hair-related services, including hairworks, wigs, and hair problem solutions.Hair Care → Hair Extensions 282 hairwork 75 wig 210 hair extension 384 Oost Gelre → Lichtenvoorde 571
kamagraoraljellykopen.nlkamagraoraljellykopen.nlMale pattern baldness, also known as androgenetic alopecia, is a common condition in men characterized by hair loss on the scalp.Appearance → Men 27 Pharmaceuticals & Medical Products → Medications 232 hair growth 32 kamagra 45
haarhuisvantongeren.nlHaarhuis van TongerenHaarhuis van Tongeren is a hair specialist with salons in Leiden and Zoetermeer offering hair extensions, hairdressing products, and advice.Hair Care → Hair Extensions 282 Dermatology → Scalp Care 402 hair extension 384 extension 1941 salon 5541 South-Holland → Leiden 7089
goederenlogistiekzorg.nlGoederenlogistiek ZorgHair loss is a common problem affecting both men and women in the Netherlands. It can have a significant impact...Anatomy & Systems → General Health 105 batana oil 24 contact lenses 538 cancer 631
looksandbrows.nlLAB – Looks and BrowsSMP offers a solution for hair loss by creating the illusion of full hair density.Beauty → Cosmetic Procedures 1147 eyeliner 98 pigmentation 98 scalp 154 lips 161 eyebrows 1127
morehair.nlBetter HairThe website focuses on solving the problem of hair loss, which is a common issue for many women.Hair Salons → Hair Care 2849 shine 50 volume 166 hair 3014 growth 4054 health 6366
saw-palmetto.nlOnbekendSaw Palmetto is also used as a possible remedy to stop hair loss.Men’s Issues → Urology 176 Disease & Treatment → Medicine 1017 prostate 24 extract 41 herbs 924
haarverdikker.nlN/AThe website offers hair products primarily aimed at treating hair loss and bald spots, targeting both men and women.Hair Care → Hair Loss Treatment 12 fiber 167 hair products 301 hairstyle 812
haarmark.nlHaarmarkHaarmark is a hair clinic in the Netherlands specializing in hair transplants and related treatments.Dermatology → Hair Clinic 20 Health → Medical Care & Services 29461 hairline 17 hair transplant 64 treatment plan 380 appointment 13510
haarwerkinstituut.nlHaarwerk Instituut NederlandHaarwerk Instituut Nederland provides custom wigs and hairpieces for individuals experiencing hair loss or thinning hair.Hair Care → Hair Loss 94 Textile Arts → Crafts 9117 hairpiece 153 wig 210 Flevoland → Lelystad 3180
haarzorg.nlHaarzorg.nlHaarzorg.nl offers hair systems, hair extensions, and advice to individuals experiencing hair loss or thinning, emphasizing personalized attention and a natural look.Dermatology → Alopecia 45 Hair Salons → Hair Care 2849 privacy 1286 extension 1941 salon 5541
kapsalontabitha.nlMarketing Bureau CompanyBoostThe anti-hair loss program offers a solution for people with thinning hair.Cosmetics & Aesthetic → Personal Care 1001 braids 33 coloring 591 hair salon 717 haircut 1158 Achtkarspelen → Twijzelerheide 46
debiologischekapsalon.nlNatuurlijke Haarstudio Annet & HillieThe salon specializes in treating skin and hair loss problems.Hair Care → Salons 1476 Cosmetics & Aesthetic → Dermatology 1980 hairstyling 482 wifi 1372 coffee 3838 Hardenberg → Dedemsvaart 413
haarpigmentatienederland.nlLauraThe website provides information and services for hair pigmentation, a solution for hair loss.Hair Care → Hair Loss 94 Dermatology → Hair Problems 76 pigmentation 98 scalp 154 confidence 1163 treatment 21203
besteshampoo.nlbesteshampoo.nlArticles addressing product buildup removal and hair loss solutions are included, essential for healthy and radiant hair.Hair Salons → Hair Care 2849 Hair Education → Hair Products 612 hair type 23 shampoo 258 review 1888 hair 3014
inekevanbelleghem.nlIneke van Belleghem HaarwerkenThe website of Ineke van Belleghem Haarwerken offers quality solutions for hair loss, focusing on personalized guidance and advice on various hairwork and hair loss solutions.Hair Care → Hair Extensions 282 Medical Care & Services → Specialty Medicine 3657 hairwork 75 hairpiece 153 treatment 21203
afrogoldhaircare.nlAfroGold Hair CareThe website addresses the issue of hair loss and offers solutions to minimize it.Hair Education → Hair Products 612 Cosmetics & Aesthetic → Hair Growth 18 conditioner 79 hair products 301 online store 905 hair 3014 growth 4054
sv-viceversa.nlSV-ViceversaHair loss, particularly after childbirth, is a common problem experienced by many women and for which the site provides advice.Disease & Treatment → Medical Information 305 Cosmetics & Aesthetic → Personal Care 1001
stichting-boz.nlStichting-bozThe website Stichting-boz provides an overview of news articles and tips on various topics, including health, finance, travel, work, and daily life.Cosmetics & Aesthetic → Personal Care 1001 tablet 998 work 3122 insurance 6359 gift 6442 house 8121
haarsalonfrizz.nlHaarsalonfrizz.nlThe website provides articles and news covering various aspects of beauty and haircare.Hair Salons → Hair Care 2849 dyson 10 cosmetics 648 hairdresser 1372 skincare 1972 hair 3014 North-Holland → Amsterdam 41253
scanton.nlScanton.nlThe website provides information about business services and developments.Disease & Treatment → Medicine 1017 burnout 1614 animation 1777 paint 8747
reflex-hairstyling.nlReflex HairstylingThe blog covers the topic of hair loss, including causes and potential solutions.Hair Salons → Hair Care 2849 Services → Hairdressers 1021 hair trend 10 olaplex 40 stylist 476 salon 5541 blog 13392 Westland → 's-Gravenzande 599
villacapelli.nlVilla Capelli Only HairThe salon recognizes that hair loss is a common issue and offers solutions and tips for clients dealing with it.Hair Salons → Hair Care 2849 hair service 12 hairpiece 153 hair extension 384 Overijssel → Haaksbergen 887
hkhaarwerken.nlInfix HaarwerkenThe website provides solutions for hair loss and thinning hair, primarily through the provision of high-quality wigs, hair extensions, and hairpieces made of real hair.Hair Care → Hair Loss 94 Hair Education → Hair Products 612 hairpiece 153 wig 210 extension 1941 repair 14576
lindahof.nlLinda Hof HaarwerkenLinda Hof Haarwerken is a company that offers hairpieces, wigs, and accessories.Hair Care → Hair Loss 94 Accessories → Hair Accessories 127 hairpiece 153 wig 210 hat 349 Eemsdelta → Appingedam 427
haarvoorhem.nlPavetteThe website addresses the issue of hair loss in men as a serious concern.Hair Care → Hairpieces 18 Children’s Issues → Human Health 37 hairpiece 153 attachment 208 ventilation 1110
haerenschaer.nlHaer & SchaerHaer & Schaer is a specialist in hairwork and offers solutions for hair problems, including advice, customization, and guidance.Eye & Vision → Human Body 21 Local & Regional Products → Local Shops 245 hairwork 75 customization 1723 price 8328
vrouwending.nlVrouwendingThe website addresses the issue of hair loss during menopause and offers suggestions for possible causes and solutions.Social Issues → Loneliness 86 Women’s Health → Menopause 228 menopause 219 nails 1719 nutrition 4935 health 6366
petrashaarstyling.nlPetrashaarstyling.nlThe website Petrashaarstyling.nl provides information and trends related to hair styling, cosmetics, health, and wellness, with a focus on hair coloring, hair loss solutions and women’s underwear.Hair Salons → Hair Care 2849 balayage 83 hair color 94 trend 1865 social media 3342
knipperz.nlKnipperZ Kapsalon Den BoschKnipperZ Kapsalon Den Bosch is a salon specializing in hair care, styling, and coloring, with a focus on natural and vegan products.Hair Care → Hair Loss 94 makeup 1477 styling 2331 hair 3014 appointment 13510 North-Brabant → 's-Hertogenbosch 8868
acxion.nlAcxionThe website sells keratin hair fibers and related products for hair thickening and hair loss.Hair Salons → Hair Care 2849 Hair Education → Hair Products 612 hair fibers 12 hairstyle 812 North-Brabant → Eindhoven 11845
haartransplantatieyildiz.nlHaartransplantatie YildizHaartransplantatie Yildiz is a clinic offering hair transplants and related treatments.Dermatology → Hair Transplantation 17 Medical Care & Services → Cosmetic Medicine 1065 hair transplant 64 result 1902 treatment 21203 North-Holland → Alkmaar 6507
haarverliesstoppen.nlHaarverliesstoppen.nlHaarverliesstoppen.nl is a website that provides information and blogs about various methods and products for hair loss and hair health.Hair Care → Hair Loss 94 Pharmaceuticals & Medical Products → Medications 232 laser therapy 142
haarstudiojohanna.nlHaarstudio JohannaThe website of Haarstudio Johanna presents a certified master hairdresser and scalp specialist who focuses on healthy hair and scalp care, with a particular emphasis on skin problems such as atopic eczema and hair loss.Hair Care → Hair Extensions 282 Cosmetics & Aesthetic → Dermatology 1980 eczema 61 scalp 154 cut 926 hair 3014 health 6366
micro-haar-pigmentatie.nlTattoo BobMicro Hair Pigmentation is primarily aimed at people experiencing hair loss and who want to create the illusion of fuller hair.Dermatology → Hair Clinic 20 follicle 10 micro hair pigmentation 19 technique 2157 South-Holland → Rotterdam 25048
haarwerkhuis.nlHet HaarwerkhuisHet Haarwerkhuis is a hair salon in Groningen that sells wigs, hair extensions, and assists customers in finding a suitable solution for hair loss.Hair Care → Hair Loss 94 Hair Education → Hair Products 612 hairpiece 153 wig 210 salon 5541 Het Hogeland → Bedum 306
kapsalon-looks.nlLooks Hair Salon and Hair SpecialistLooks is a hair salon and hair specialist located in Groningen, offering personalized attention and expertise for various hair needs.Medical Care & Services → Medical 188 Local & Regional Products → Local Shops 245 hairpiece 153 haircut 1158 hairdresser 1372 appointment 13510 Netherlands → Groningen 23734
haarwerkplus.nlHaarwerk PlusHaarwerk Plus is a company specializing in custom-made hairpieces and ready-made hair extensions, as well as offering advice on hair and scalp problems. They are affiliated with industry organizations and are known for their customer focus.Hair Salons → Hair Care 2849 Accessories → Hair Accessories 127 hairpiece 153 hair products 301 complaint 6479
haarwerkstudio-riabrouwers.nlHaarwerkstudio Ria BrouwersHaarwerkstudio Ria Brouwers provides wigs and hairpieces with personalized guidance and advice for people experiencing hair loss.Hair Care → Hair Loss 94 hairpiece 153 wig 210 collection 7566
marjohairdesign.nlMarjo Hair Beauty & HaarwerksalonMarjo Hairdesign is a hair salon and beauty salon dedicated to creating beautiful hairstyles and treatments for both men and women, with a special focus on hair extensions and hair loss solutions.Hair Care → Hair Loss 94 Dermatology → Scalp Care 402 hair extension 384 hairstyle 812 styling 2331 treatment 21203
pruiken-haarwerken-stein.nlKapsalon & Haarwerken Leony Dames en HerenKapsalon & Haarwerken Leony in Stein offers hairpieces and wigs and assists clients with hair loss.Hair Salons → Hair Care 2849 hairpiece 153 wig 210 cosmetics 648 Limburg → Stein 628
haar-werken.nlEcht Haar KliniekEcht Haar Kliniek offers hair systems to address hair loss and baldness, creating a beautiful full-haired look.Dermatology → Hair Problems 76 clinic 1079
cathriensturmhoeden.nlCathrien Sturm HoedenCathrien Sturm Hoeden is a website featuring an atelier and webshop for the design and production of hats, including specially designed hats for people experiencing hair loss.Accessories → Hats 177 Crafts → Felting 110 felt 208 hat 349 atelier 1417 collection 7566 workshop 19325 North-Holland → Amsterdam 41253
haircareirismelis.nlIris MelisThe Hair Care Iris Melis website offers solutions for various forms of hair loss and specializes in creating custom hair wigs.Hair Care → Hair Loss 94 Crafts → Textile Work 134 custom made 146 intake 467 diagnosis 1490 hair 3014
kapsalonmarian.nlKapsalon MarianKapsalon Marian’s website provides information about the salon, its services, and contact details.Cosmetics & Aesthetic → Personal Care 1001 scalp 154 hair 3014 salon 5541 treatment 21203 Drenthe → Assen 3516
haargroeimiddel-kopen.nlCure|GenThe website offers a range of hair growth products and shampoos aimed at combating hair loss and stimulating hair growth.Hair Care → Hair Loss 94 shampoo 258 spray 658
nanogen.nlnanogenThe website offers hair fibers to camouflage hair loss and make hair appear fuller.Hair Care → Hair Loss 94 Hair Education → Hair Products 612 hair fibers 12 volume 166
haar-herstel.nlHaar HerstelThe website Haar Herstel offers hair growth treatments in Amsterdam and Rotterdam, focused on treating hair loss and stimulating natural hair growth.Dermatology → Hair Clinic 20 Health → Medical Care & Services 29461 result 1902 hair 3014 treatment 21203 South-Holland → Rotterdam 25048
nigeldenniskayaks.nlNigel Dennis KayaksNigel Dennis Kayaks is a website offering a variety of information and product offerings including travel advice, gardening tips, shoes and technology.Skiing → Ski Equipment 36 Scandinavia → Norway 71 water damage 84 norway 97 skis 121 shoes 2699
livage-haarwerken.nlLiVage HaarwerkenLiVage Haarwerken offers wigs, hairpieces, and hairpieces for people experiencing hair loss.Hair Salons → Hair Care 2849 hairpiece 153 wig 210 salon 5541 Meierijstad → Veghel 1288
open-txt.nlRedactieThe website Open TXT offers various articles and blog posts on diverse topics, including memorial monuments, skin problems, hair loss, washboards, gardening, and sports.Dermatology → Skin Conditions 61 laundry service 24 corn 101 typography 155 snowboard 352 garden 13129
wellness365.nlwellness365.nlThe website Wellness365 offers a range of health-related articles and tips, including information on hair loss, exercise, hearing problems, and the benefits of arginine.Anatomy & Systems → General Health 105 Disease & Treatment → Medical Information 305 hearing loss 40 exercise 706 article 6000 health 6366
datispechhaarweg.nlDAT IS PECH HAAR WEGThe website specifically focuses on the issue of hair loss and offers solutions and advice for women experiencing it.Trauma & Recovery → Loss 714 Personal Development → Self-Confidence 703 confidence 1163 interview 1371 tips 2789 blog 13392
atelier10b.nlAtelier 10bThe website of Atelier 10b presents a theater hairdresser and makeup artist workshop that produces and maintains custom wigs and hairpieces for professional musical productions, and also operates as Zorgpunt Livage, providing hairpieces to individuals experiencing hair loss.Dentistry → Prosthetics 91 Theater → Theater Productions 22 hairpiece 153 wig 210 theater 2544 workshop 19325 Oude IJsselstreek → Sinderen 46
dehaartransplantatiekliniek.nlThe HaartransplantatiekliniekThe Haartransplantatie Kliniek is a Dutch clinic specializing in hair transplants, particularly using the FUE method.Primary Care → Clinics 1009 hair transplant 64 treatment plan 380 clinic 1079
haarzaken.nlHaarzakenThe salon offers specific treatments to combat hair loss and restore the scalp.Hair Education → Hair Products 612 dyes 14 stylist 476 haircut 1158 Haarlemmermeer → Badhoevedorp 604
daanenmaan.nlDaan&Maan HaarboetiekDaan&Maan Haarboetiek offers hair solutions and treatments for hair and scalp, with a focus on natural and healthy methods.Hair Care → Hair Loss 94 hairwork 75 hairpiece 153 scalp 154 hair 3014 salon 5541
themooimakerij.nlSaskiaThe salon offers solutions for hair loss and dandruff.Hair Salons → Hair Care 2849 curls 229 hair 3014 relaxation 3968 massage 7646 treatment 21203
nlwearhair.nlNL Wear HairNL Wear Hair provides solutions for hair loss, including wigs, hair systems, and hair thickeners, with a focus on customization and quality.Hair Care → Hair Loss 94 Hair Care → Hair Extensions 282 hairpiece 153 volume 166 wig 210 hair extension 384
perfect-clinic.nlPerfect ClinicThe clinic also offers specific treatments for hair loss, such as XL-Hair.Dermatology → Skin Problems 31 Arts & Culture → Cosmetic Education 28 skin problems 220 skin 2518 massage 7646 education 13471 treatment 21203 Gelderland → Nijkerk 3608
ninahair.nlFerGi B.V.The salon focuses on treating various forms of hair loss, including alopecia and hair loss due to medical causes.Dermatology → Hair Problems 76 hairwork 75 certification 3380 South-Holland → Rotterdam 25048
clinerience.nlClinerienceThe website of Clinerience is an online shop where customers can purchase products from Clinique du Cheveu for hair care.Cosmetics & Skincare → Cosmetics 1122 Cosmetics & Aesthetic → Dermatology 1980 hair dye 63 scalp 154 shampoo 258 hair 3014 treatment 21203
lemooree.nlLemooreeThe website offers Lemooree Hair Growth Fibers, a natural solution for hair loss and baldness.Hair Care → Hair Loss 94 Hair Education → Hair Products 612 fiber 167 appearance 248 confidence 1163
folisin.nlFolisinMale hair loss can be caused by various factors, including genetic predispositions and hormonal imbalances. Folisin provides a solution to these problems.Hair Care → Hair Loss 94 Women’s Health → Hormones 149 ingredients 2346 hair 3014 stress 3965
vitaleafit.nlN.V.The website provides information and guidance for women, particularly women of color, regarding their health and vitality, and offers solutions for specific challenges such as menopause and hair problems.Nutrition → Nutritional Advice 646 Pregnancy & Childbirth → Women’s Health 968 menopause 219 supplement 1968 fitness 2251 nutrition 4935 health 6366
hairgro.nlHairgroThe website Hairgro offers solutions for hair loss, hair fall, and stimulating new hair growth, targeting both men and women.Hair Care → Hair Loss Treatment 12 conditioner 79 serum 162 capsule 209 shampoo 258
hismancave.nlN.V.The article discusses the causes of hair loss in men and available solutions, such as hair transplants.Eye & Vision → Human Body 21 Men’s Issues → Men 92 man cave 28 sex 88 flirt 127
profolan.nlProfolanThe website focuses on men experiencing hair loss or hair loss and offers a solution in the form of Profolan.Dermatology → Hair Growth 10 hair growth 32
kliniekolivier.nlKliniek OlivierHair loss is treated with PRP and PRF, which promote hair growth and reduce loss.Medical Care & Services → Cosmetic Medicine 1065 Medical Care & Services → Plastic Surgery 281 eyelid correction 53 botox 244 filler 293 skin 2518 North-Holland → Haarlem 8674
wingenshaarwerken.nlWingens HaarwerkenThe salon provides solutions for various types of hair loss, including alopecia and thinning hair.Hair Salons → Hair Care 2849 Hair Education → Hair Products 612 davines 14 hairpiece 153 wig 210 hairstyle 812 North-Brabant → Oss 2962
gratispruiken.nlFree WigsThe website originated as a response to the high cost of wigs and the need to offer women with hair loss an affordable solution.Dermatology → Alopecia 45 Special Needs & Support → Support 2006 wig 210 woman 1419
haarwerk.nlHaarinstituut NederlandHaarinstituut Nederland is a hair specialist located in Hilversum that helps clients with hair and scalp problems and offers hair extensions.Hair Care → Hair Extensions 282 Dermatology → Hair Problems 76 clientele 46 hairpiece 153 scalp 154 treatment 21203 North-Holland → Hilversum 4397
berinocare.nlBerino CareBerino Care is a company specializing in hair loss, scalp problems, and wigs, offering personalized guidance and treatments.Hair Care → Hair Extensions 282 Cosmetics & Aesthetic → Dermatology 1980 wig 210 hair 3014 treatment 21203
esta-haarwerken.nlEsta HaarwerkenEsta Haarwerken is a hairwork studio in Winterswijk that focuses on providing professional advice and hairworks for various hair problems and client segments.Hair Education → Hair Products 612 Dermatology → Hair Problems 76 hairwork 75 wig 210 salon 5541 Gelderland → Winterswijk 1221
haarwerkstudiomaastricht.nlHaarwerkstudio MaastrichtHaarwerkstudio Maastricht provides hair extensions, custom solutions, and care products for people experiencing hair loss or scalp issues.Hair Care → Hair Extensions 282 Dermatology → Alopecia 45 care products 142 scalp 154 hair extension 384 Limburg → Maastricht 6008
hairflow.nlHairflowThe Hairflow website provides hairpiece and wig consultation services, aimed at increasing self-confidence and offering solutions for hair loss.Hair Care → Hair Loss 94 Hair Education → Hair Products 612 hairpiece 153 wig 210
purdeyshairstyling.nlPurdey’s HairstylingThe salon specializes in treating various forms of hair loss, including androgenetic alopecia and alopecia areata, and hair loss after chemotherapy and radiotherapy.Dermatology → Alopecia 45 Cosmetics & Skincare → Cosmetics 1122 hair problem 30 hairpiece 153 hairstyling 482 salon 5541 North-Holland → Hoorn 3090
haarwerkenfriesland.nlteamharryhummelHaarwerken Friesland is a specialized salon in Friesland that offers hairpieces for people experiencing hair loss.Hair Care → Hair Extensions 282 Disease & Treatment → Conditions 174 hairpiece 153 salon 5541 De Fryske Marren → Joure 689
hairsolutionsclinic.nlHair Solutions ClinicThe website focuses on offering solutions for various forms of hair loss.Beauty → Cosmetic Procedures 1147 powder brows 77 eyebrows 1127 treatment 21203 De Ronde Venen → Mijdrecht 700
prpclinic.nlPRP ClinicPRP treatment is primarily used to reduce hair loss by stimulating the hair follicles and slowing down hair loss.Hair Care → Hair Loss 94 Health → Medical Care & Services 29461 hair growth 32 prp 56 scalp 154 treatment 21203
teslamed.nlTesla Med BeneluxThe trichology treatment focuses on stimulating hair growth and preventing hair loss by delivering ingredients to the hair follicles without needles.Medical Care & Services → Cosmetic Medicine 1065 blepharoplasty 26 patent 100 treatment 21203
secrethairshop.nlSecret Hair SolutionSecret Hair Solution is a company specializing in special solutions for hair loss and focusing on professionals and the training of hair specialists.Hair Salons → Hair Care 2849 Medical Care & Services → Medical Equipment & Aids 518 partnership 1407 salon 5541 training 28133
tophaarverlieskopen.nlFESHFENThe website offers a selection of hair care products and accessories, focusing on treating hair loss and stimulating hair growth.Hair Care → Hair Loss 94 Hair Care → Hair Extensions 282 shampoo 258 oil 970 extension 1941 hair 3014
folicerin.nlFolicerinThe website of Folicerin is an online store offering an innovative shampoo against hair loss.Appearance → Men 27 Hair Salons → Hair Care 2849 hair follicle 14 blood circulation 57 scent 333 hair 3014
niostem.nlNiostem GmbHThe website offers a wearable helmet, niostem, that claims to promote hair growth without medication or surgery.Hair Care → Hair Loss 94 Medical Care & Services → Medical Equipment & Aids 518 helmet 236 hair 3014 technology 6816
bvh11.nlBerino CareBerino Care is a salon specializing in solutions for hair loss, scalp problems, and providing hair extensions.Hair Care → Hair Extensions 282 Dermatology → Scalp Care 402 scalp 154 extension 1941 hair 3014 treatment 21203 Netherlands → Friesland 27911
hairdoctors.nlHairdoctorsHairdoctors specializes in treating various forms of hair loss, such as male and female baldness.Cosmetics & Aesthetic → Dermatology 1980 Medical Care & Services → Cosmetic Medicine 1065 scalp 154 hair 3014 patient 4082 treatment 21203 North-Brabant → Tilburg 8759
fierohaarwerken.nlFiero HaarwerkenFiero Haarwerken is a specialist in hairworks, wigs, and extensions offering solutions for hair loss, particularly as a result of cancer or alopecia.Cancer → Chemotherapy 11 mind-walk 18 hairwork 75 wig 210 health insurance 287 salon 5541 North-Brabant → Bladel 779
haartransplantatiekosten.nlhaartransplantatiekosten.nlThe website provides independent information and tips about hair transplants, focusing on costs and different methods.Hair Care → Hair Loss 94 Health → Medical Tourism 20 hair follicle 14 hair transplant 64 cost 1990 treatment 21203
markanti-haarwerken.nlMarkanti Hair & BeautyThe website of Markanti Hairworks offers solutions for hair loss and personalized hair extensions, with a focus on feeling confident and stylish.Hair Care → Hair Loss 94 Hair Care → Hair Extensions 282 hairwork 75 hair extension 384 salon 5541
frisshaarwerken.nlFriss Haarwerken & WigsThe website of Friss Haarwerken & Wigs in Etten-Leur offers personalized advice and custom wigs and wigs to help people maintain their identity during hair loss.Hair Care → Hairpieces 18 Disease & Treatment → Conditions 174 wig 210 identity 1028 certification 3380 North-Brabant → Etten-Leur 1366
haarwerktwente.nlDion HairconceptDion Hairconcept is a hairwork specialist in Twente offering hair solutions for both men and women, and providing treatments for hair loss.Hair Care → Hair Extensions 282 hairwork 75 coffee 3838 salon 5541 Overijssel → Haaksbergen 887
dsddeluxe.nlDSD de LuxeDSD de Luxe Netherlands is an online store specializing in hair care products and treatments, particularly focusing on combating hair loss and improving hair health.Hair Salons → Hair Care 2849 Cosmetics & Aesthetic → Personal Care 1001 conditioner 79 restructuring 142 shampoo 258 haircare 469
microscalp.nlMicroscalpHair loss, also known as alopecia, is a common problem that Microscalp addresses.Hair Education → Hair Products 612 Dermatology → Hair Problems 76 North-Holland → Amsterdam 41253
123haarverdikker.nl123HaarverdikkerThe hair thickeners offer a solution for problems with hair loss and bald patches.Hair Salons → Hair Care 2849 Hair Education → Hair Products 612 keratin 61 fiber 167 kit 526
degeldersepruikenmaker.nlThe Gelderse PruikenmakerThe Gelderse Pruikenmaker is a specialist in Doetinchem offering 30 years of experience in wigs and hairpieces, providing advice and assistance.Disease & Treatment → Medical Conditions 47 Crafts & DIY → Craft Services 27 hairpiece 153 wig 210 care 12338 Gelderland → Doetinchem 2706
haargroeiapotheek.nlHaargroei ApotheekThe website offers professional hair growth products, specifically finasteride, dutasteride, and minoxidil, aimed at treating hair loss.Hair Care → Hair Loss 94 Mental & Emotional Well-Being → Endocrinology 23 testosterone 46
raspberry-ketone-burner.nlN.V.The website provides information about raspberry ketone, including its potential benefits for weight loss and hair loss, and advice on purchasing supplements.Hair Care → Hair Loss 94 Supplements → Natural Supplements 152 metabolism 98 weight loss 678
anatvangelder.nlAnat van GelderThe article on hair loss discusses the causes and effects of this common issue.Disease & Treatment → Medical Information 305 Health → Medical Care & Services 29461 care home 130 gloves 292 podiatrist 326 health 6366
as-stichting.nlStichting AS Wimpers & WenkbrauwenThe foundation focuses on patients experiencing hair loss due to cancer treatments, and offers support through artificial eyelashes and eyebrows.Hair Salons → Hair Trends 225 Diseases → Cancer 546 brow 96 wig 210 eyelash 354 volunteer 8367 training 28133 South-Holland → The Hague 19898
classic-trust.nlClassic TrustThe Classic Trust website is a specialist in stimulating hair activation and treating hair loss and baldness using natural products and a specific treatment method.Dermatology → Hair Problems 76 Medical Care & Services → Cosmetic Medicine 1065 hair follicle 14 anti-aging 95 laser 868 treatment 21203
dutabiot.nlDutabiotDutabiot stands for innovation and scientific backing in the fight against hair loss.Hair Care → Hair Loss 94 ship 5103 security 6655
fully.nlFullyThis website offers hair solutions, including hair loss camouflage products and hair growth stimulating products.Hair Salons → Hair Care 2849 hair salon 717
haar2.nlHaar2The website of Haar2 presents a hair salon specializing in hair extensions and solutions for hair problems, particularly hair loss, baldness, and transgender look alternatives, and offers personalized advice and a focus on customer satisfaction.Hair Care → Hair Extensions 282 Dermatology → Hair Problems 76 hair problem 30 hair extension 384 hairdresser 1372
haarmodeheleen.nlHaarmode HeleenHaarmode Heleen is a salon specializing in the creation and fitting of hair extensions, wigs, and hairpieces, with a particular focus on providing advice and support for hair loss.Hair Care → Hair Loss 94 Hair Care → Hair Extensions 282 hairpiece 153 wig 210 salon 5541
haaruitval-stoppen.nlFrankThe website haaruitval-stoppen.nl is a personal blog by Frank, detailing his own experiences with hair loss and hair care, including information on hair growth and hair loss.Hair Care → Hair Loss 94 hair growth 32 haircare 469
haaruitvalvoorkomen.nlhaaruitvalvoorkomen.nlThis website provides information about hair loss, including causes, symptoms, treatments, and preventative measures.Hair Care → Hair Loss 94 Dermatology → Hair Growth 10 vitamin 469 hair 3014 stress 3965 nutrition 4935
hair4hair.nlHair4HairHair4Hair offers hair fibers as a solution for hair loss and thinning hair, thereby addressing the problem.Hair Salons → Hair Care 2849 Cosmetics & Aesthetic → Hair Growth 18 applicator 12 hair fibers 12 conditioner 79 shampoo 258
hairgrowthsolutions.nlHairGrowth SolutionsHairGrowthSolutions offers natural hair products and treatments for various hair problems and treatments.Hair Salons → Hair Care 2849 hair 3014 care 12338 treatment 21203
hairlab.nlHL ClinicsThe website of Hairlab clinic focuses on treating hair loss in men and women in Amsterdam.Primary Care → Clinics 1009 Dermatology → Hair Problems 76 hair 3014 treatment 21203 North-Holland → Amsterdam 41253
hairtattootwente.nlHair Tattoo TwenteThe website focuses on addressing hair loss through various techniques.Dermatology → Hair Problems 76 Cosmetics & Skincare → Cosmetics 1122 alopecia 19 micro hair pigmentation 19 scar 142 volume 166
hwkc.nlHaarWerken specialist K&C Hair WorldHaarWerken specialist K&C Hairworld is a website offering solutions for hair loss, thinning hair, and baldness.Hair Salons → Hair Care 2849 Medical Care & Services → Cosmetic Medicine 1065 hairpiece 153 wig 210 hair extension 384 Texel → Den Hoorn 333
kliniek-voor-echt-haar.nlEchthaar KliniekEcht Haar Kliniek provides hair reconstruction and solutions for hair loss.Specialty Medicine → Specialists 158 Dermatology → Hair Problems 76
kwetsbaarkrachtigmooi.nlWillemijnThis website, owned by Willemijn, presents her personal experiences with hair loss, specifically caused by Alopecia Areata, and offers insights from her research into dramatherapy.Personal Stories → Blogs 33 Personal Stories → Illness 103 dramatherapy 33 humor 353 blog 13392
laserkliniekaanzee.nlLaserkliniek aan ZeeLaserkliniek aan Zee offers permanent hair removal treatments in Katwijk.Cosmetics & Aesthetic → Cosmetic Procedures 157 laser 868 treatment 21203 South-Holland → Katwijk 2183
ledsgrowhair.nlLEDS grow hairThe website addresses the causes and consequences of hair loss, particularly in men and women.Hair Salons → Hair Care 2849 led lamps 63 device 698 hairdresser 1372 therapy 7448
lifestyleforhim.nlLifestyle for HimThe website provides information and tips for modern men on various aspects of their lives, including finances, personal development, and well-being.Men’s Issues → Men 92 Medical Care & Services → Plastic Surgery 281 self confidence 106 water softener 324 style 2348 balance 4582
luxuryhairandbeauty.nlLuxury Hair and BeautyThe website Luxury Hair and Beauty in Leiden offers a wide range of services in the fields of hairdressing, beauty, wellness, and slimming, with the goal of helping customers improve their personal beauty and well-being.Beauty → Cosmetic Procedures 1147 Health → Cosmetics & Aesthetic 4579 infrared sauna 26 beauty specialist 188 laser hair removal 294 hairdresser 1372 South-Holland → Leiden 7089
mesoclinic.nlMeso ClinicThe Meso Clinic Rotterdam website offers mesotherapy treatments for hair loss and thinning hair, aiming to help customers regain a full head of hair.Dermatology → Hair Problems 76 hair follicle 14 mesotherapy 56 treatment 21203 South-Holland → Rotterdam 25048
microhair.nlMicro Hair by ÖmerHair loss is the problem addressed by Micro Hair Pigmentation, offering a natural solution.Hair Salons → Hair Trends 225 Dermatology → Hair Problems 76 micro hair pigmentation 19 scar 142 aftercare 224 consulting 3639
mmhp.nlMichael's Micro Hair PigmentationMicro hair pigmentation is a treatment aimed at people with hair loss or a receding hairline, offering an alternative to traditional hair transplantation.Cosmetics & Aesthetic → Dermatology 1980 Medical Care & Services → Cosmetic Medicine 1065 pigmentation 98 tattoo 799 hair 3014 salon 5541 treatment 21203 Utrecht → Nieuwegein 2264
natuurlijkmetdees.nlNatuurlijk met DeesNatuurlijk met Dees is a bio hair wellness salon specializing in relaxing, customized treatments for scalp and hair problems.Hair Salons → Hair Care 2849 Services → Hairdressers 1021 scalp 154 hair 3014 relaxation 3968 treatment 21203
plateletgel.nlplateletgel.nlThis website provides information and articles related to Platelet-Rich Plasma (PRP) treatments and their applications.Disease & Treatment → Conditions 174 Health → Medical Care & Services 29461 osteoarthritis 53 acne 399
rootsclinic.nlRoots ClinicRoots Clinic is a medical-cosmetic clinic specializing in injectables and skin improvement, aiming to combine inner peace and outer beauty.Dermatology → Skin Therapy 661 Medical Care & Services → Cosmetic Medicine 1065 injectables 153 skin therapy 221 laser 868
serumgeeks.nlSerumGeeksSerumGeeks offers effective skin and hair care products, focused on eyelash and eyebrow growth, and emphasizes scientifically-backed formulas.Appearance → Men 27 serum 162 shampoo 258 eyelash 354 hair 3014
toppunthaarwerken.nlGerda Miedema HairworksThe website of hairstylist Gerda Miedema offers solutions for hair loss and baldness in women, especially those over 40, and is committed to helping women with this issue regain confidence.Hair Care → Hair Loss 94 Health → Cosmetics & Aesthetic 4579 alopecia 19 hairpiece 153 hairstyle 812
haarmark-drachten.nlHaarmarkThe clinic offers solutions for various forms of hair loss, including a receding hairline and thinning hair.Dermatology → Hair Transplantation 17 Medical Care & Services → Cosmetic Medicine 1065 hair transplant 64 checklist 426 result 1902 treatment 21203
haarzorglisette.nlHaarzorg LisetteHaarzorg Lisette is a specialist in providing customized hair solutions for individuals experiencing hair problems and hair loss.Hair Salons → Hair Care 2849 Health → Cosmetics & Aesthetic 4579 personalized care 27 hair problem 30 hairpiece 153 hair extension 384
kristenhair.nlKristenHairThe website offers chewable, sugar-free hair vitamins, Kristen Hair Unicorn, designed to reduce hair loss and strengthen and stimulate hair growth.Hair Care → Hair Loss 94 nails 1719 ingredients 2346 skin 2518
haaruitvalproducten.nlN.V. HaaruitvalproductenThe website 'Hair Loss Products' provides information and articles about the causes, solutions, and supplements related to hair loss.Hair Care → Hair Loss 94 vitamin e 10 protein 299 hormone 563
hairtattoobyyvonne.nlHair Tattoo by YvonneThe website of Hair Tattoo by Yvonne offers micro hair pigmentation (MHP) as a solution for hair loss in women and men, aiming to help them feel more confident in their appearance.Dermatology → Hair Clinic 20 Dermatology → Hair Problems 76 micro hair pigmentation 19 pigment 142 scalp 154 confidence 1163 results 3954
mhpspecialist.nlMHP SpecialistMicro hair pigmentation is a solution for people suffering from hair loss, especially early baldness. The procedure uses pigment to visually thicken the hair.Hair Care → Hair Loss 94 Dermatology → Hair Problems 76 scar 142 pigment 142 results 3954 treatment 21203
nisimbenelux.nlNisim InternationalThe website presents Nisim International’s hair care technology, products for hair loss prevention and hair growth stimulation, emphasizing clinically proven effectiveness.Hair Salons → Hair Care 2849 Supply Chain & Logistics → International Trade 1156 research 8967
hair-skintherapy.nlHair & Skin Therapy by Dayenne StylingHair & Skin Therapy by Dayenne is a salon in Arnhem offering skin and hair therapy treatments.Medical Care & Services → Cosmetic Medicine 1065 Health → Cosmetics & Aesthetic 4579 skin rejuvenation 241 acne 399 treatment 21203 Gelderland → Arnhem 8680
lastvanhaaruitval.nlLastVanHaaruitval.nlThe website LastVanHaaruitval.nl offers a supplement, Foligain, to treat hair loss and hair growth problems.Hair Care → Hair Loss 94 Pharmaceuticals & Medical Products → Medications 232 dosage 52 supplement 1968 ingredients 2346 hair 3014
miracoil.nlMirac'OilHair loss is an unpleasant condition with various causes, including genetic factors.Hair Salons → Hair Care 2849 serum 162 hair 3014
mhpstudio.nlMHP Studio NDHair loss is addressed by the website using the MHP technique, providing a camouflage solution.Hair Care → Hair Loss 94 Dermatology → Hair Problems 76 micro hair pigmentation 19 pigment 142 instagram 1216 studio 5465 appointment 13510 Netherlands → Utrecht 48901
browsandbeauty.nlBrows & BeautyHair loss refers to the process of unwanted hair loss, for which the website offers a specific treatment.Trade → Local Trade 61 Eyelash Services → Eyebrows 777 brow lamination 26 henna brows 66 powder brows 77 eyebrows 1127 Utrecht → Nieuwegein 2264
maaik-s-borsten.nlmaaik-s-borsten.nlThis website contains updates and personal reports from someone undergoing cancer treatment, including details about chemotherapy sessions, hair loss, and daily experiences.Illness → Cancer 10 chemotherapy 35 updates 200 whatsapp 382 treatment 21203
demari-huidverzorging.nlApotheken Almere Buiten BVThe website offers products specifically targeted at treating hair loss.Cosmetics & Aesthetic → Dermatology 1980 Pharmaceuticals & Medical Products → Health Products 134 formulation 51 dermatologist 62 acne 399
b-yourself.nlB-yourselfThe B-yourself website is a specialist salon providing hair systems and treatments for hair loss, with a focus on personalized care and custom solutions.Hair Care → Hair Loss 94 Dermatology → Hair Growth 10
theskintherapy.nlThe Skin TherapyThe website of The Skin Therapy is a skin therapist clinic specializing in skin, hair, and scalp improving treatments for various skin conditions and issues.Cosmetics & Aesthetic → Dermatology 1980 Beauty → Cosmetic Procedures 1147 skin treatment 81 acne 399 appointment 13510